 |
|
 |
| |
| Toxin Name |
μ-agatoxin-Ao1a |
| Source Species |
Agelena orientalis |
| Toxin Group |
Agatoxin |
| Description |
Toxin identified from mRNA showing strong sequence homologies to the insecticidal μ-agatoxin-Aa1 from the venom of the related species Agelenopsis aperta that induces an irreversible spastic paralysis when injected into insects by modifying presynaptic voltage-gated sodium channels, causing them to open at the normal resting potential of the nerve. |
| Discovered |
2004 |
|
Sex: Female, Prosoma length: 5mm
Photo courtesy of Bastian Rast
Use of photo governed by creative
commons noncommercial license
|
| This toxin last updated on Aug 20, 2010 |
|
| Current Taxonomy |
Historic Taxonomy |
| Kingdom |
Animalia |
| Phylum |
Arthropoda |
| Class |
Arachnida |
| Order |
Araneae |
| Infra-order |
Araneomorphae |
| Family |
Agelenidae |
| Genus |
Agelena |
| Species |
orientalis |
|
| Agelena taurica |
| Agelena gracilens taurica |
| Agelena labyrinthica orientalis |
| Agelena orientalis |
| Agelena similis taurica |
| Agelena syriaca |
|
|
| Molecular Target |
ED50 |
IC50 |
Kd |
Pharmacophore |
Comment |
| Sodium channel, voltage-gated (para-type) (invertebrate) |
|
|
|
|
assumed activity based on sequence homology to the insecticidal μ-agatoxin-Aa1 |
|
| Original Deposition References |
Kozlov S., Malyavka A., Grishin E., McCutchen B., Lu A., Schepers E., Herrmann R.
Submitted (JUL-2004) to the EMBL/GenBank/DDBJ databases.
Predicted toxin-like structures from spider venom gland mRNA.
|
| Other References |
Kozlov S., Malyavka A., McCutchen B., Lu A., Schepers E., Herrmann R., Grishin E.
Proteins Apr 1;59(1):131-40(2005).
A novel strategy for the identification of toxinlike structures in spider venom.
|
|
| Disulfide Bonds |
Posttranslational modifications |
| Left Residue |
Right Residue |
Evidence |
| 2 |
17 |
By homology |
| 9 |
22 |
By homology |
| 16 |
32 |
By homology |
| 24 |
30 |
By homology |
|
| Residue Number |
Type |
Symbol |
| 36 |
C-terminal amidation (By similarity) |
NH₂ |
|
|
| Peptide Sequences |
>as:μ-agatoxin-Ao1a|sp:Q5Y4U7 Translation of mRNA sequence for toxin μ-agatoxin-Ao1a from spider Agelena orientalis.
MKAIIFFCFLSVMVFIVAEASSLEALKIFEGERDCVGENGRCRDWYNDCCDGFYCSCRQP
PYCICRNNNG |
Full BLAST |
BLAST mature toxin only
|
| mRNA Sequences |
>s:μ-agatoxin-Ao1a|gb:AY681337 mRNA sequence of toxin μ-agatoxin-Ao1a from spider Agelena orientalis.
GCACGAGGATTGCAGAAAAATCGTGCATTGGAAAAAGGTATTTTTCCGATAAATTTATTA
GCTGGATTACAATATGGTGAACATGAAAGCTATAATTTTCTTCTGTTTCTTATCTGTGAT
GGTCTTTATCGTGGCTGAAGCAAGCTCTTTAGAAGCTTTAAAGATCTTTGAAGGAGAAAG
GGATTGCGTGGGTGAAAACGGACGCTGCAGAGATTGGTATAATGATTGCTGTGATGGATT
CTACTGCAGTTGCAGGCAACCACCTTATTGTATCTGCAGAAATAACAATGGATAAACGCT
GGTTTCAACTGAATACAGATATTTTTTCATTGATCAGTTGTACTGTGTATTTTTTTCACG
TGTAATGTATGAAATTTTGCACATTCCAACAAAATATATTGAAATTTGAATATGAA |
Full BLAST
|
|
| Synonym |
Type |
| U3-agatoxin-Ao1l |
Recommended full name |
| μ-agatoxin-Ao1a |
Recommended full name |
| U3-AGTX-Ao1l |
Recommended abbreviation |
| μ-AGTX-Ao1a |
Recommended abbreviation |
| μ-2Aga_13 |
Synonym |
|
|
|
|
|
 |
|
 |
|
|
