 |
|
 |
| |
| Toxin Name |
κ-hexatoxin-Hv1a |
| Source Species |
Hadronyche versuta (Blue Mountains funnel-web spider) |
| Toxin Group |
Hexatoxin |
| Description |
Insecticidal toxin from Blue Mountains funnel-web spider. Lethal to a wide variety of insects but inactive when injected into rabbits and newborn mice. Blocks insect but not vertebrate calcium-activated potassium channels. Contains an extremely rare vicinal disulfide bond that is critical for toxin activity. |
| Discovered |
2000 |
|
|
| This toxin last updated on Oct 14, 2008 |
|
| Current Taxonomy |
Historic Taxonomy |
| Kingdom |
Animalia |
| Phylum |
Arthropoda |
| Class |
Arachnida |
| Order |
Araneae |
| Infra-order |
Mygalomorphae |
| Family |
Hexathelidae |
| Genus |
Hadronyche |
| Species |
versuta |
|
| Hadronyche versuta |
| Pseudatrax moreaui |
| Aname bicolor |
| Atrax bicolor |
| Atrax versuta |
|
|
| Molecular Target |
ED50 |
IC50 |
Kd |
Pharmacophore |
Comment |
| Potassium channel, calcium-activated (Slo-type) (invertebrate) |
|
|
|
|
|
| Taxon |
ED50 |
LD50 |
PD50 |
Qualitative Information |
| Acheta domesticus |
|
303.0
pmol/g
|
|
Native toxin, by injection
|
|
| Original Deposition References |
Wang X.-H., Connor M., Smith R., Maciejewski M.W., Howden M.E.H., Nicholson G.M., Christie M.J., King G.F.
Nat. Struct. Biol. 7:505-513(2000).
Discovery and characterization of a family of insecticidal neurotoxins with a rare vicinal disulfide bridge.
|
|
| Disulfide Bonds |
| Left Residue |
Right Residue |
Evidence |
| 3 |
17 |
By homology |
| 10 |
22 |
By homology |
| 13 |
14 |
By homology |
| 16 |
33 |
By homology |
|
|
| Peptide Sequences |
>as:κ-hexatoxin-Hv1a|sp:P82227 Insecticidal toxin from Blue Mountains funnel-web spider Hadronyche versuta TICTGADRPCAACCPCCPGTSCQGPESNGVVYCRNF |
Full BLAST |
BLAST mature toxin only
|
|
| Synonym |
Type |
| κ-hexatoxin-Hv1a |
Recommended full name |
| κ-HXTX-Hv1a |
Recommended abbreviation |
| κ-atracotoxin-Hv1a |
Synonym |
| Janus-atracotoxin-Hv1a |
Synonym |
| κ-ACTX-Hv1a |
Synonym (abbreviation) |
| Janus-ACTX-Hv1a |
Synonym (abbreviation) |
| J-atracotoxin-Hv1a |
Synonym (abbreviation) |
|
|
|
|
|
 |
|
 |
|
|