advanced search user manual

	Toxin Name μ-agatoxin-Aa1f Source Species Agelenopsis  aperta (Western grass spider) Toxin Group Agatoxin Description Insecticidal neurotoxin that induces an irreversible spastic paralysis when injected into insects. Modifies presynaptic voltage-gated sodium channels, causing them to open at the normal resting potential of the nerve. This leads to spontaneous release of neurotransmitter and repetitive action potentials in motor neurons. Present at a concentration of ~1.6 mM in Agelenopsis aperta venom. An engineered baculovirus expressing a transgene encoding the related toxin μ-agatoxin-Aa1d has improved insecticidal efficacy. Discovered 1988 This toxin last updated on Jul 21, 2010 Taxonomy Current Taxonomy Historic Taxonomy Kingdom Animalia Phylum Arthropoda Class Arachnida Order Araneae Infra-order Araneomorphae Family Agelenidae Genus Agelenopsis Species aperta Agelena aperta Agelenopsis aperta Agelenopsis aperta guttata Agelenopsis gertschi Biological Activity Neurotoxin Molecular Target ED50 IC50 Kd Pharmacophore Comment Sodium channel, voltage-gated (para-type) (invertebrate) Taxon ED50 LD50 PD50 Qualitative Information Musca domestica 150.0  pmol/g Manduca sexta 9135.0  pmol/g LD50 value converted from literature value of 38 ug/g using a molecular weight of 4159.6 Da for the fully oxidized peptide Accessions Source Accession ArachnoServer AS000385 HSSP P11057 InterPro IPR016328 InterPro IPR009243 NCBI_Taxon 6908 PDB 1EIT Pfam PF05980 PIR F32038 PIRSF PIRSF001882 PROSITE PS60015 UniProt P11062 Literature References Original Deposition References Skinner W.S., Adams M.E., Quistad G.B., Kataoka H., Cesarin B.J., Enderlin F.E., Schooley D.A. J. Biol. Chem. 264:2150-2155(1989). Purification and characterization of two classes of neurotoxins from the funnel web spider, Agelenopsis aperta. Other References Adams M.E., Herold E.E., Venema V.J. Journal of Comparative Physiology A 164:333-342(1989) Two classes of channel-specific toxins from funnel web spider venom. Omecinsky D.O., Holub K.E., Adams M.E., Reily M.D. Biochemistry 35:2836-2844(1996) Three-dimensional structure analysis of mu-agatoxins: further evidence for common motifs among neurotoxins with diverse ion channel specificities. Prikhod'ko G.G., Robson M., Warmke J.W., Cohen C.J., Smith M.M., Wang P., Warren V., Kaczorowski G., Van der Ploeg L.H.T., Miller L.K. Biological Control 7:236-244(1996) Properties of Three Baculovirus-Expressing Genes That Encode Insect-Selective Toxins: μ-Aga-IV, As II, and Sh I Adams M.E. Toxicon 43:509-525(2004) Agatoxins: ion channel specific toxins from the American funnel web spider, Agelenopsis aperta. Protein Information Disulfide Bonds Left Residue Right Residue Evidence 2 18 By homology 9 23 By homology 17 33 By homology 25 31 By homology Sequences Peptide Sequences >as:μ-agatoxin-Aa1f|sp:P11062 Insecticidal neurotoxin (mu-Aga VI) from the spider Agelenopsis aperta DCVGESQQCADWAGPHCCDGYYCTCRYFPKCICVNNN Full BLAST BLAST mature toxin only Toxin Synonyms Synonym Type μ-agatoxin-Aa1f Recommended full name μ-AGTX-Aa1f Recommended abbreviation μ-agatoxin VI Synonym μ-Aga VI Synonym (abbreviation)
©2010 Queensland Facility for Advanced Bioinformatics (Version 3.0) We greatly appreciate your feedback, comments or questions Internal: log in