 |
|
 |
| |
| Toxin Name |
U4-theraphotoxin-Hhn1v |
| Source Species |
Haplopelma hainanum (Chinese Black Earth Tiger tarantula) |
| Toxin Group |
Theraphotoxin |
| Description |
This toxin is presumed to be lethal to cockroach and mice based on holomogy to U4-theraphotoxin-Hhn1a from the same species. |
| Discovered |
2010 |
|
|
| This toxin last updated on Aug 30, 2014 |
|
| Current Taxonomy |
Historic Taxonomy |
| Kingdom |
Animalia |
| Phylum |
Arthropoda |
| Class |
Arachnida |
| Order |
Araneae |
| Infra-order |
Mygalomorphae |
| Family |
Theraphosidae |
| Genus |
Haplopelma |
| Species |
hainanum |
|
| "Ornithoctonus" "hainana" |
| "Haplopelma" "hainanum" |
| "Selenocosmia" "hainana" |
|
|
| Molecular Target |
ED50 |
IC50 |
Kd |
Pharmacophore |
Comment |
| Molecular target unknown |
|
|
|
|
|
| Taxon |
ED50 |
LD50 |
PD50 |
Qualitative Information |
| Mus musculus |
|
|
|
Lethal based on homology to U4-theraphotoxin-Hhn1a
|
| Periplaneta americana |
|
|
|
Lethal based on homology to U4-theraphotoxin-Hhn1a
|
|
| Original Deposition References |
Tang X., Zhang Y., Hu W., Xu D., Tao H., Yang X., Li Y., Jiang L., Liang S.
J. Proteome Res. 9:2550-2564(2010).
Molecular diversification of peptide toxins from the tarantula Haplopelma hainanum (Ornithoctonus hainana) venom based on transcriptomic, peptidomic, and genomic analyses.
|
|
| Disulfide Bonds |
| Left Residue |
Right Residue |
Evidence |
| 3 |
17 |
By homology |
| 7 |
28 |
By homology |
| 22 |
33 |
By homology |
|
|
| Peptide Sequences |
>as:U4-theraphotoxin-Hhn1v|sp:P0CH77 Toxin from venom of the spider Haplopelma hainanum with unknown molecular target
FECSVSCEIEKEGNKDCKKKKCKGGWKCKFNMCVKDI |
Full BLAST |
BLAST mature toxin only
|
|
| Synonym |
Type |
| U4-theraphotoxin-Hhn1v |
Recommended full name |
| U4-TRTX-Hhn1v |
Recommended abbreviation |
| Hainantoxin F8-17.06 |
Synonym |
| Peptide F8-17.06 |
Synonym |
|
|
|
|
|
 |
|
 |
|
|
