 |
|
 |
| |
| Toxin Name |
U10-theraphotoxin-Hhn1b |
| Source Species |
Haplopelma hainanum (Chinese Black Earth Tiger tarantula) |
| Toxin Group |
Theraphotoxin |
| Description |
Toxin with unknown target and function. |
| Discovered |
2010 |
|
|
| This toxin last updated on Sep 09, 2014 |
|
| Current Taxonomy |
Historic Taxonomy |
| Kingdom |
Animalia |
| Phylum |
Arthropoda |
| Class |
Arachnida |
| Order |
Araneae |
| Infra-order |
Mygalomorphae |
| Family |
Theraphosidae |
| Genus |
Haplopelma |
| Species |
hainanum |
|
| "Ornithoctonus" "hainana" |
| "Haplopelma" "hainanum" |
| "Selenocosmia" "hainana" |
|
|
| Molecular Target |
ED50 |
IC50 |
Kd |
Pharmacophore |
Comment |
| Molecular target unknown |
|
|
|
|
|
|
| Original Deposition References |
Tang X., Zhang Y., Hu W., Xu D., Tao H., Yang X., Li Y., Jiang L., Liang S.
J. Proteome Res. 9:2550-2564(2010).
Molecular diversification of peptide toxins from the tarantula Haplopelma hainanum (Ornithoctonus hainana) venom based on transcriptomic, peptidomic, and genomic analyses.
|
|
| Peptide Sequences |
>as:U10-theraphotoxin-Hhn1b|sp:D2Y2B8 Toxin from venom of the spider Haplopelma hainanum with unknown molecular target
MKLCAVIIASLLVCVAVASSSDNQKEFAQEKEMTREETQSLGEHEKDDEVTGSEERSCIE
EWKTCENDCECCGMSTLCAASWVDGHQIKLCRNVGGKLKKVLHFIQKSVSKIKSCKK |
Full BLAST |
BLAST mature toxin only
|
|
| Synonym |
Type |
| U10-theraphotoxin-Hhn1b |
Recommended full name |
| U10-TRTX-Hhn1b |
Recommended abbreviation |
| Hainantoxin-XV-2 |
Synonym |
| HNTX-XV-2 |
Synonym (abbreviation) |
|
|
|
|
|
 |
|
 |
|
|
