advanced search user manual

	Toxin Name μ-theraphotoxin-Hhn2a Source Species Haplopelma  hainanum (Chinese Black Earth Tiger tarantula) Toxin Group Theraphotoxin Description Toxin inhibits neuronal TTX-sensitive voltage-gated sodium (Nav) channels. No effect on TTX-resistant Nav channels and voltage-gated calcium channels. It has been suggested that the toxin acts on site 1 of the channel. Discovered 2003 This toxin last updated on Sep 16, 2014 Taxonomy Current Taxonomy Historic Taxonomy Kingdom Animalia Phylum Arthropoda Class Arachnida Order Araneae Infra-order Mygalomorphae Family Theraphosidae Genus Haplopelma Species hainanum "Ornithoctonus" "hainana" "Haplopelma" "hainanum" "Selenocosmia" "hainana" Biological Activity Neurotoxin Molecular Target ED50 IC50 Kd Pharmacophore Comment Sodium channel, voltage-gated (vertebrate): Vertebrate NaV channel, non-selective 1.1  nM Inhibition of TTX-sensitive Nav currents by native toxin. Accessions Source Accession ArachnoServer AS000339 GO GO:0009405 InterPro IPR013140 InterPro IPR011696 NCBI_Taxon 209901 PDB 2JTB Pfam PF07740 PROSITE PS60021 UniProt D2Y1X9 UniProt H3A01_HAPHA UniProt D2Y1Y0 UniProt H3A02_HAPHA UniProt D2Y1Y1 UniProt H3A03_HAPHA UniProt D2Y1Y2 UniProt H3A04_HAPHA UniProt D2Y1Y3 UniProt H3A05_HAPHA UniProt D2Y1Z4 UniProt H3A06_HAPHA UniProt D2Y1Z7 UniProt H3A07_HAPHA UniProt D2Y1Z8 UniProt H3A08_HAPHA UniProt D2Y2D1 UniProt H3A09_HAPHA UniProt D2Y2D2 UniProt H3A10_HAPHA UniProt D2Y2D3 UniProt H3A11_HAPHA UniProt D2Y2I3 UniProt H3A12_HAPHA UniProt P83464 Literature References Original Deposition References Tang X., Zhang Y., Hu W., Xu D., Tao H., Yang X., Li Y., Jiang L., Liang S. J. Proteome Res. 9:2550-2564(2010). Molecular diversification of peptide toxins from the tarantula Haplopelma hainanum (Ornithoctonus hainana) venom based on transcriptomic, peptidomic, and genomic analyses. Zhu Q., Liu Z., Liang S. Submitted (JUL-2007) to the PDB data bank. Three dimensional solution structure of hainantoxin-III by 2D 1H- NMR. Zhu Q., Liu Z.-H., Liang S.-P. Submitted (OCT-2002) to UniProtKB. Function and solution structure of hainantoxin-III, a potent neuronal TTX-sensitive sodium channel antagonist from Chinese bird spider Selenocosmia hainana. Other References Xiao Y., Liang S. Eur. J. Pharmacol. 477:1-7(2003). Inhibition of neuronal tetrodotoxin-sensitive Na+ channels by two spider toxins: hainantoxin-III and hainantoxin-IV. Protein Information Disulfide Bonds Posttranslational modifications Left Residue Right Residue Evidence 2 17 Experimentally determined 9 22 Experimentally determined 16 29 Experimentally determined Residue Number Type Symbol 33 C-terminal amidation NH₂ Sequences Peptide Sequences >as:μ-theraphotoxin-Hhn2a_1|sp:P83464 Toxin from venom of the spider Haplopelma hainanum that inhibits voltage-gated sodium channels GCKGFGDSCTPGKNECCPNYACSSKHKWCKVYL Full BLAST BLAST mature toxin only >as:μ-theraphotoxin-Hhn2a_2|sp:D2Y1X9 Toxin from venom of the spider Haplopelma hainanum that inhibits voltage-gated sodium channels MKASMFLALAGLVLLFVVGYASESEEKEFPRELLSKIFAVDDFKGEERGCKGFGDSCTPG KNECCPNYACSSKHKWCKVYLGK Full BLAST BLAST mature toxin only >as:μ-theraphotoxin-Hhn2a_3|sp:D2Y1Y0 Toxin from venom of the spider Haplopelma hainanum that inhibits voltage-gated sodium channels MKASMYLALAGLVLLFVVGYASESEEKEFPRELLSKIFAVDDFKGEERGCKGFGDSCTPG KNECCPNYACSSKHKWCKVYLGK Full BLAST BLAST mature toxin only >as:μ-theraphotoxin-Hhn2a_4|sp:D2Y1Y1 Toxin from venom of the spider Haplopelma hainanum that inhibits voltage-gated sodium channels MKASMFLALAGLVLLFVVGYASESEEKEFPRELLSKIFALDDFKGEERGCKGFGDSCTPG KNECCPNYACSSKHKWCKVYLGK Full BLAST BLAST mature toxin only >as:μ-theraphotoxin-Hhn2a_5|sp:D2Y1Y2 Toxin from venom of the spider Haplopelma hainanum that inhibits voltage-gated sodium channels MKASMYLALAGLVLLFVVGYASESEEKEFPRELLSKIFAVDDFKGKERGCKGFGDSCTPG KNECCPNYACSSKHKWCKVYLGK Full BLAST BLAST mature toxin only >as:μ-theraphotoxin-Hhn2a_6|sp:D2Y1Y3 Toxin from venom of the spider Haplopelma hainanum that inhibits voltage-gated sodium channels MKASRFLALAGLVLLFVVGYASESEEKEFPRELLSKIFAVDDFKGEERGCKGFGDSCTPG KNECCPNYACSSKHKWCKVYLGK Full BLAST BLAST mature toxin only >as:μ-theraphotoxin-Hhn2a_7|sp:D2Y1Z4 Toxin from venom of the spider Haplopelma hainanum that inhibits voltage-gated sodium channels MKASMFLALAGLVLLFVVGYASESEEKESPRELLSKIFAVDDFKGEERGCKGFGDSCTPG KNECCPNYACSSKHKWCKVYLGK Full BLAST BLAST mature toxin only >as:μ-theraphotoxin-Hhn2a_8|sp:D2Y1Z7 Toxin from venom of the spider Haplopelma hainanum that inhibits voltage-gated sodium channels MKASMFLALAGLVLLFVVGYASESEEKEFPRELLSKVFAVDDFKGEERGCKGFGDSCTPG KNECCPNYACSSKHKWCKVYLGK Full BLAST BLAST mature toxin only >as:μ-theraphotoxin-Hhn2a_9|sp:D2Y1Z8 Toxin from venom of the spider Haplopelma hainanum that inhibits voltage-gated sodium channels MKASMFLALAGLVLLFVVGYASESEEKEFPRELLSKIFAVDDFTGEERGCKGFGDSCTPG KNECCPNYACSSKHKWCKVYLGK Full BLAST BLAST mature toxin only >as:μ-theraphotoxin-Hhn2a_10|sp:D2Y2D1 Toxin from venom of the spider Haplopelma hainanum that inhibits voltage-gated sodium channels MKASMFLALAGLALLFVVCYASESEEKEFPIELLSKIFAVDVFKGEERGCKGFGDSCTPG KNECCPNYACSSKHKWCKVYLGK Full BLAST BLAST mature toxin only >as:μ-theraphotoxin-Hhn2a_11|sp:D2Y2D2 Toxin from venom of the spider Haplopelma hainanum that inhibits voltage-gated sodium channels MKASMFLALAGLVRLFVVGYASESEEKEFPRELLSKIFAVDDFKGEERGCKGFGDSCTPG KNECCPNYACSSKHKWCKVYLGK Full BLAST BLAST mature toxin only >as:μ-theraphotoxin-Hhn2a_12|sp:D2Y2D3 Toxin from venom of the spider Haplopelma hainanum that inhibits voltage-gated sodium channels MKASMFLALAGLVLLFVVGYASESEEKDFPRELLSKIFAVDDFKGEERGCKGFGDSCTPG KNECCPNYACSSKHKWCKVYLGK Full BLAST BLAST mature toxin only >as:μ-theraphotoxin-Hhn2a_13|sp:D2Y2I3 Toxin from venom of the spider Haplopelma hainanum that inhibits voltage-gated sodium channels MKASMFLALAGLVLLFVVGYASGSEEKEFPRELLSKIFAVDDFKGEERGCKGFGDSCTPG KNECCPNYACSSKHKWCKVYLGK Full BLAST BLAST mature toxin only Toxin Synonyms Synonym Type μ-theraphotoxin-Hhn2a Recommended full name μ-TRTX-Hhn2a Recommended abbreviation Hainantoxin-III.12 Synonym Hainantoxin-3.5 Synonym Hainantoxin-3.6 Synonym Hainantoxin-III.6 Synonym Hainantoxin-3.7 Synonym Hainantoxin-III.7 Synonym Hainantoxin-3.8 Synonym Hainantoxin-III.8 Synonym Hainantoxin-3.9 Synonym Hainantoxin-III.9 Synonym Hainantoxin-3.10 Synonym Hainantoxin-III.10 Synonym Hainantoxin-3.11 Synonym Hainantoxin-III.11 Synonym Hainantoxin-3.12 Synonym Hainantoxin-III.5 Synonym Hainantoxin-3.2 Synonym Peptide F7-18.76 Synonym Hainantoxin-3 Synonym Hainantoxin-III.2 Synonym Hainantoxin-3.3 Synonym Hainantoxin-III.3 Synonym Hainantoxin-3.4 Synonym Hainantoxin-III Synonym Hainantoxin-III.4 Synonym HnTx-III.11 Synonym (abbreviation) HNTX-III Synonym (abbreviation) HNTX-3 Synonym (abbreviation) HnTx-III.10 Synonym (abbreviation) HnTx-III Synonym (abbreviation) HnTx-III.9 Synonym (abbreviation) HnTx-III.4 Synonym (abbreviation) HnTx-III.8 Synonym (abbreviation) HnTx-III.2 Synonym (abbreviation) HnTx-III.7 Synonym (abbreviation) HnTx-III.6 Synonym (abbreviation) HnTx-III.3 Synonym (abbreviation) HnTx-III.5 Synonym (abbreviation) HnTx-III.12 Synonym (abbreviation) Toxin Structure Please click a structure to view:
©2010 Queensland Facility for Advanced Bioinformatics (Version 3.0) We greatly appreciate your feedback, comments or questions Internal: log in