 |
|
 |
| |
| Toxin Name |
κ-theraphotoxin-Gr2b |
| Source Species |
Grammostola rosea (Chilean rose tarantula) |
| Toxin Group |
Theraphotoxin |
| Description |
The toxin inhibits voltage-gated potassium channels from the archaebacterium Aeropyrum pernix by binding to the voltage sensor paddle (S3-S4 helices). The toxin exerts its effect by partitioning into the lipid membrane with the preferred location of the toxin being the membrane/water interface. Based on very close homology with κ-TRTX-Gr2a and κ-TRTX-Ps2b, the toxin also likely to be a weak blocker of mechanosensitive channel and a high-affinity blocker of mammalian Kv4.2 and Kv4.3 channels. |
| Discovered |
2004 |
|
Sex: female
, Prosoma length: 26mm
Photo courtesy of Bastian Rast
Use of photo governed by creative
commons noncommercial license
|
| This toxin last updated on Sep 03, 2010 |
|
| Current Taxonomy |
Historic Taxonomy |
| Kingdom |
Animalia |
| Phylum |
Arthropoda |
| Class |
Arachnida |
| Order |
Araneae |
| Infra-order |
Mygalomorphae |
| Family |
Theraphosidae |
| Genus |
Grammostola |
| Species |
rosea |
|
| Grammostola rosea |
| Grammostola spathulata |
| Grammostola argentinensis |
| Grammostola cala |
| Lasiodora rosea |
| Mygale rosea |
| Grammostola spatulata |
| Grammostola spatulatus |
| Mygale rubiginosa |
| Citharoscelus kochii |
| Grammostola argentinense |
| Eurypelma spatulatum |
| Eurypelma rosea |
| Citharoscelus spatulatus |
|
|
| Molecular Target |
ED50 |
IC50 |
Kd |
Pharmacophore |
Comment |
| Potassium channel, voltage-gated (archaebacterium): KvAP (from Aeropyrum pernix) |
|
|
|
|
20000 nM produces 30% inhibition of KvAP expressed in Escherichia coli. |
|
| Disulfide Bonds |
| Left Residue |
Right Residue |
Evidence |
| 2 |
16 |
By homology |
| 9 |
21 |
By homology |
| 15 |
25 |
By homology |
|
|
| Peptide Sequences |
>as:κ-theraphotoxin-Gr2b|sp:P0C2P4 Toxin from venom of the spider Grammostola rosea that blocks voltage-gated potassium channels YCQKWMWTCDEERKCCEGLVCRLWCKKKIEEG |
Full BLAST |
BLAST mature toxin only
|
|
| Synonym |
Type |
| κ-theraphotoxin-Gr2b |
Recommended full name |
| κ-TRTX-Gr2b |
Recommended abbreviation |
| Voltage sensor toxin 2 |
Synonym |
| VSTX2 |
Synonym (abbreviation) |
|
|
|
|
|
 |
|
 |
|
|