 |
|
 |
| |
| Toxin Name |
U1-segestritoxin-Sf1a |
| Source Species |
Segestria florentina (Tube-web spider) |
| Toxin Group |
Segestritoxin |
| Description |
Insecticidal toxin. Molecular target unknown. |
| Discovered |
1987 |
|
Sex: female, Prosoma length: 5mm
Photo courtesy of Bastian Rast
Use of photo governed by creative
commons noncommercial license
|
| This toxin last updated on Jan 15, 2015 |
|
| Current Taxonomy |
Historic Taxonomy |
| Kingdom |
Animalia |
| Phylum |
Arthropoda |
| Class |
Arachnida |
| Order |
Araneae |
| Infra-order |
Araneomorphae |
| Family |
Segestriidae |
| Genus |
Segestria |
| Species |
florentina |
|
| Aranea cellaria |
| Aranea florentina |
| Aranea perfida |
| Aranea subterranea |
| Segestria cellaria |
| Segestria florentina |
| Segestria gracilis |
| Segestria perfida |
| Segestria senoculata |
|
|
| Original Deposition References |
Sagdiev N.Z., Valieva L.A., Korneev A.S., Sadykov A.A., Salikhov S.I.
Bioorg. Khim. 13:1013-1018(1987).
Toxic components of the venom of the cellar spider Segestria florentina.
|
|
| Peptide Sequences |
>as:U1-segestritoxin-Sf1a|sp:P61504 Insecticidal toxin from the spider Segestria florentina
RQDMVDESVCYITDNNCNGGKCLRSKACHADPWEL |
Full BLAST |
BLAST mature toxin only
|
|
| Synonym |
Type |
| U1-segestritoxin-Sf1a |
Recommended full name |
| U1-SGTX-Sf1a |
Recommended abbreviation |
| Insectotoxin SIT |
Synonym |
|
|
|
|
|
 |
|
 |
|
|
