| |
| Toxin Name |
ω-agatoxin-Aa4b |
| Source Species |
Agelenopsis aperta (Western grass spider) |
| Toxin Group |
Agatoxin |
| Description |
ω-agatoxin-Aa4b is a paralog of the classical Cav2.1 blocker ω-agatoxin-Aa4a (ω-Aga-IVA) that has insecticidal activity. It was simultaneously discovered by groups in Japan and the USA and named ω-agatoxin Tsukuba (ω-Aga-TK) and ω-agatoxin IVB (ω-Aga-IVB). The toxin was subsequently shown to be a post-translationally modified form of ω-agatoxin-Aa4c (ω-Aga-IVC) in which Ser46 is epimerized from the L- to the D-stereoisomer by a novel cofactor-independent peptide isomerase found in the venom. Isomerization of Ser46 to the D-configuration improves the activity of the toxin by ~90-fold against Cav2.1 (P-type) channels in rat cerebellar Purkinje neurons and increases the resistance of the toxin to proteases.
Although the level of identity between the two toxins is only 71%, the specificity and affinity of ω-AGTX-Aa4b for Cav2.1 channels is indistinguishable from that of ω-AGTX-Aa4a, although the kinetics of block are somewhat slower for ω-AGTX-Aa4b. As for ω-AGTX-Aa4a, the disordered C-terminal "tail" is essential for activity. It has been suggested that the role of the "tail" might be to simply anchor the toxins to the cell membrane via interaction with either the lipid bilayer or transmembrane regions of the Cav channel.
The toxin is present in venom at a concentration of 0.8-1.0 mM.
|
| Discovered |
1993 |
|
|
| This toxin last updated on Aug 20, 2010 |
|
| Current Taxonomy |
Historic Taxonomy |
| Kingdom |
Animalia |
| Phylum |
Arthropoda |
| Class |
Arachnida |
| Order |
Araneae |
| Infra-order |
Araneomorphae |
| Family |
Agelenidae |
| Genus |
Agelenopsis |
| Species |
aperta |
|
| Agelena aperta |
| Agelenopsis aperta |
| Agelenopsis aperta guttata |
| Agelenopsis gertschi |
|
|
| Molecular Target |
ED50 |
IC50 |
Kd |
Pharmacophore |
Comment |
| Calcium channel, voltage-gated (vertebrate): CaV2.1 |
|
|
3.0
nM
|
|
Value for block of Cav2.1 (P-type) channels in Purkinje neurons. |
|
| Original Deposition References |
Adams M.E., Mintz I.M., Reily M.D., Thanabal V., Bean B.P.
Mol. Pharmacol. 44:681-688 (1993)
Structure and properties of omega-agatoxin IVB, a new antagonist of P-type calcium channels.
|
Teramoto T., Kuwada M., Niidome T., Sawada K., Nishizawa Y., Katayama K.
Biochem. Biophys. Res. Commun. 196:134-140 (1993)
A novel peptide from funnel web spider venom, omega-Aga-TK, selectively blocks, P-type calcium channels.
|
Kuwada M., Teramoto T., Kumagaye K.Y., Nakajima K., Watanabe T., Kawai T., Kawakami Y., Niidome T., Sawada K., Nishizawa Y.
Mol. Pharmacol. 46:587-593 (1994)
Omega-agatoxin-TK containing D-serine at position 46, but not synthetic omega-[L-Ser46]agatoxin-TK, exerts blockade of P-type calcium channels in cerebellar Purkinje neurons.
|
Heck S.D., Kelbaugh P.R., Kelly M.E., Thadeio P.F., Saccomano N.A., Stroh J.G., Volkmann R.A.
J. Am. Chem. Soc. 116:10426-10436 (1994)
Disulfide bond assignment of omega-agatoxins IVB and IVC: discovery of a D-serine residue in omega-agatoxin IVB
|
| Other References |
Olivera B.M., Imperial J.S., Cruz L.J., Bindokas V.P., Venema V.J., Adams M.E.
Ann. NY Acad. Sci. 635:114-122 (1991)
Calcium channel-targeted polypeptide toxins
|
Yu H., Rosen M.K., Saccomano N.A., Phillips D., Volkmann R.A., Schreiber S.L.
Biochemistry 32:13123-13129 (1993)
Sequential assignment and structure determination of spider toxin omega-Aga-IVB.
|
Heck S.D., Siok C.J., Krapcho K.J., Kelbaugh P.R., Thadeio P.F., Welch M.J., Williams R.D., Ganong A.H., Kelly M.E., Lanzetti A.J.
Science 266:1065-1068 (1994)
Functional consequences of posttranslational isomerization of Ser46 in a calcium channel toxin.
|
Shikata Y, Watanabe T, Teramoto T, Inoue A, Kawakami Y., Nishizawa Y., Katayama K., Kuwada M.
J. Biol. Chem. 270:16719-16723 (1995)
Isolation and characterization of a peptide isomerase from funnel web spider venom
|
Reily M.D., Thanabal V., Adams M.E.
J. Biomol. NMR 5:122-32 (1995)
The solution structure of omega-Aga-IVB, a P-type calcium channel antagonistfrom venom of the funnel web spider, Agelenopsis aperta.
|
Adams M.E.
Toxicon 43:509-525 (2004)
Agatoxins: ion channel specific toxins from the American funnel web spider, Agelenopsis aperta.
|
King G.F.
Toxicon 49:513-530 (2007)
Modulation of insect Ca(v) channels by peptidic spider toxins
|
|
| Disulfide Bonds |
Posttranslational modifications |
| Left Residue |
Right Residue |
Evidence |
| 4 |
20 |
Experimentally determined |
| 12 |
25 |
Experimentally determined |
| 19 |
36 |
Experimentally determined |
| 27 |
34 |
Experimentally determined |
|
| Residue Number |
Type |
Symbol |
| 46 |
D-serine |
D-Ser |
|
|
| Peptide Sequences |
>as:ω-agatoxin-Aa4b|sp:P37045 Potent Cav2.1 blocker (ω-Aga-IVB/TK) from the venom of the spider Agelenopsis aperta MKLCMTLLITAIAVVTFVVATQEESAEFNEVEESREDNCIAEDYGKCTWGGTKCCRGRPC RCSMIGTNCECTPRLIMEGLSFA |
Full BLAST |
BLAST mature toxin only
|
| mRNA Sequences |
>as:ω-agatoxin-Aa4b|gb:U15925 cDNA sequence for potent Cav2.1 blocker (ω-Aga-IVB/TK) from the venom of the spider Agelenopsis aperta GGAAAACGCATTCATTTACTTTGAACTTTTTCGTTCACCGGTTTCAAGTTTTTCTAACCA GTTATGAAGCTGTGTATGACTCTGTTGATAACAGCAATTGCTGTTGTGACTTTCGTCGTG GCAACACAGGAAGAAAGTGCAGAATTTAATGAAGTAGAAGAATCAAGAGAAGATAATTGC ATTGCCGAAGATTACGGAAAATGCACATGGGGCGGAACAAAATGCTGCCGGGGACGCCCA TGTCGCTGCAGCATGATTGGGACGAATTGTGAATGTACACCAAGATTAATAATGGAAGGT TTGTCATTTGCGTGAACTTGGTAAAGATCTCAAGCAGAATAGCGATGGAGCAGAACATCT AGTTTACTTACAATTATATTAATATTATATTAAATAATCCTCAAATAAGGATGTATAATT TTGTGATGAAATTAAAAATTCTTTATTCGC |
Full BLAST
|
|
| Synonym |
Type |
| ω-agatoxin-Aa4b |
Recommended full name |
| ω-AGTX-Aa4b |
Recommended abbreviation |
| ω-agatoxin IVB |
Synonym |
| ω-agatoxin Tsukuba |
Synonym |
| ω-Aga-IVB |
Synonym (abbreviation) |
| Omega-Aga-TK |
Synonym (abbreviation) |
|
|
|