 |
|
 |
| |
| Toxin Name |
β-theraphotoxin-Ps1a |
| Source Species |
Paraphysa scrofa (Chilean copper tarantula) |
| Toxin Group |
Theraphotoxin |
| Description |
β-TRTX-Ps1a blocks several subtypes of voltage-gated sodium channels, especially Nav1.2, by shifting the voltage dependence of channel activation to more depolarized potentials and by blocking the inward component of the sodium current. |
| Discovered |
2005 |
|
Sex: Female, Prosoma length: 14mm
Photo courtesy of Martin Huesser
Use of photo governed by creative
commons noncommercial license
|
| This toxin last updated on Jun 02, 2009 |
|
| Current Taxonomy |
Historic Taxonomy |
| Kingdom |
Animalia |
| Phylum |
Arthropoda |
| Class |
Arachnida |
| Order |
Araneae |
| Infra-order |
Mygalomorphae |
| Family |
Theraphosidae |
| Genus |
Paraphysa |
| Species |
scrofa |
|
| Phrixotrichus chilensis |
| Phrixotrichus roseus |
| Phrixotrichus scrofa |
| Aranea scrofa |
| Mygale chilensis |
| Mygale rosea |
| Paraphysa manicata |
| Paraphysa scrofa |
| Phrixotrichus auratus |
|
|
| Molecular Target |
ED50 |
IC50 |
Kd |
Pharmacophore |
Comment |
| Sodium channel, voltage-gated (vertebrate): NaV1.1 |
|
610.0
nM
|
|
|
Inhibition of Nav1.1 channels expressed in oocytes by native toxin |
| Sodium channel, voltage-gated (vertebrate): NaV1.2 |
|
0.6
nM
|
|
|
Inhibition of Nav1.2 channels expressed in oocytes by native toxin |
| Sodium channel, voltage-gated (vertebrate): NaV1.3 |
|
42.0
nM
|
|
|
Inhibition of Nav1.3 channels expressed in oocytes by native toxin |
| Sodium channel, voltage-gated (vertebrate): NaV1.4 |
|
288.0
nM
|
|
|
Inhibition of Nav1.4 channels expressed in oocytes by native toxin |
| Sodium channel, voltage-gated (vertebrate): NaV1.5 |
|
72.0
nM
|
|
|
Inhibition of Nav1.5 channels expressed in oocytes by native toxin |
| Sodium channel, voltage-gated (vertebrate): NaV1.8 |
|
|
|
|
65% inhibition of Nav1.8 channels expressed in oocytes at a concentration of 2000 nM of native toxin |
| Taxon |
ED50 |
LD50 |
PD50 |
Qualitative Information |
| Mus musculus |
|
|
|
Injection of 500 pmol toxin i.c.v. causes general ataxia, flaccid paralysis and death after 10-20 min
|
|
| Original Deposition References |
Bosmans F., Rash L., Zhu S., Diochot S., Lazdunski M., Escoubas P., Tytgat J.
Mol. Pharmacol. 69:419-429(2006).
Four novel tarantula toxins as selective modulators of voltage-gated sodium channel subtypes.
|
|
| Disulfide Bonds |
| Left Residue |
Right Residue |
Evidence |
| 2 |
17 |
By homology |
| 9 |
23 |
By homology |
| 16 |
30 |
By homology |
|
|
| Peptide Sequences |
>as:β-theraphotoxin-Ps1a|sp:P84510 Toxin from venom of the spider Paraphysa scrofa that inhibits voltage-gated sodium channels
DCLGFLWKCNPSNDKCCRPNLVCSRKDKWCKYQI |
Full BLAST |
BLAST mature toxin only
|
|
| Synonym |
Type |
| β-theraphotoxin-Ps1a |
Recommended full name |
| β-TRTX-Ps1a |
Recommended abbreviation |
| Phrixotoxin-3 |
Synonym |
| PaurTx3 |
Synonym (abbreviation) |
|
|
|
|
|
 |
|
 |
|
|
