 |
|
 |
| |
| Toxin Name |
μ-theraphotoxin-Cg1a |
| Source Species |
Chilobrachys guangxiensis |
| Toxin Group |
Theraphotoxin |
| Description |
The toxin inhibits TTX-sensitive voltage-gated sodium channels in rat dorsal root ganglion (DRG) neurons, but not TTX-resistant voltage-gated sodium channels or voltage-gated potassium channels of the subtype Kv2.1 that are expressed in frog oocytes. Trapping of the voltage sensor in the resting conformation has been suggested as the possible mechanism, which would be similar to the suggested mechanism for μ-theraphotoxin-Hh2a, although the binding sites for both toxins should not overlay completely. |
| Discovered |
2008 |
|
Sex: female, Prosoma length: 29mm
Photo courtesy of Bastian Rast
Use of photo governed by creative
commons noncommercial license
|
| This toxin last updated on Jan 08, 2010 |
|
| Current Taxonomy |
| Kingdom |
Animalia |
| Phylum |
Arthropoda |
| Class |
Arachnida |
| Order |
Araneae |
| Infra-order |
Mygalomorphae |
| Family |
Theraphosidae |
| Genus |
Chilobrachys |
| Species |
guangxiensis |
|
|
| Molecular Target |
ED50 |
IC50 |
Kd |
Pharmacophore |
Comment |
| Sodium channel, voltage-gated (vertebrate): Tetrodotoxin-sensitive NaV channel |
|
85.0
nM
|
|
|
not active on tetrodotoxin-resistant NaV channels; all Nav channels from rat dorsal root ganglion neurons. |
|
| Original Deposition References |
Chen J., Deng M., He Q., Meng E., Jiang L., Liao Z., Rong M., Liang S.
Cell. Mol. Life Sci. 65:2431-2444(2008).
Molecular diversity and evolution of cystine knot toxins of the tarantula Chilobrachys jingzhao.
|
Liao Z., Cao J., Li S., Yan X., Hu W., He Q., Chen J., Tang J., Xie J., Liang S.
Proteomics 7:1892-1907(2007).
Proteomic and peptidomic analysis of the venom from Chinese tarantula Chilobrachys jingzhao.
|
Chen J., Zhang Y., Rong M., Zhao L., Jiang L., Zhang D., Wang M., Xiao Y., Liang S.
Peptides 30:1042-1048(2009).
Expression and characterization of jingzhaotoxin-34, a novel neurotoxin from the venom of the tarantula Chilobrachys jingzhao.
|
|
| Disulfide Bonds |
Posttranslational modifications |
| Left Residue |
Right Residue |
Evidence |
| 2 |
16 |
|
| 9 |
21 |
|
| 15 |
29 |
|
|
| Residue Number |
Type |
Symbol |
| 35 |
C-terminal amidation |
NH₂ |
|
|
| Peptide Sequences |
>as:μ-theraphotoxin-Cg1a|sp:B1P1F7 Toxin from venom of the spider Chilobrachys guangxiensis that inhibits voltage-gated sodium channels
MKVLVLITLAVLGAMFVWTSAAELEERGSDQRDSPAWVKSMERIFQSEERACREWLGGCS
KDADCCAHLECRKKWPYHCVWDWTVRK |
Full BLAST |
BLAST mature toxin only
|
| mRNA Sequences |
>as:μ-theraphotoxin-Cg1a|gb:EU233888 cDNA of a toxin from the venom gland of the spider Chilobrachys guangxiensis
GTTGAGTCTGAACTAACGGATCGGTTTTCACTTACTGCGGAATCACCTGTTGCTGGTAAC
TGTACTGCACTGAAGACAATGAAGGTTTTAGTACTAATAACTCTGGCTGTATTGGGGGCC
ATGTTTGTTTGGACTTCTGCTGCTGAACTAGAAGAACGTGGTTCGGATCAGAGGGACTCT
CCTGCATGGGTAAAATCTATGGAGAGAATATTTCAGTCTGAAGAAAGAGCTTGCAGGGAG
TGGCTTGGAGGCTGTTCCAAAGATGCGGACTGCTGTGCACACTTGGAATGCCGAAAGAAG
TGGCCATATCATTGTGTATGGGATTGGACTGTCCGCAAATGAGTTATCCTGATTACAATG
AATAATATTTGAATTGCCTCTTTGGATTCACGATTTTCGGTTTAAAAGTTTTCAATAAAT
GAATACCACAAAAGTCTTGGACCAAGAAAAAAAAAAAAAAA |
Full BLAST
|
|
| Synonym |
Type |
| μ-theraphotoxin-Cg1a |
Recommended full name |
| μ-TRTX-Cg1a |
Recommended abbreviation |
| Jingzhaotoxin-34 |
Synonym |
| μ-theraphotoxin-Cj1a |
Synonym |
| JZTX-34 |
Synonym (abbreviation) |
| μ-TRTX-Cj1a |
Synonym (abbreviation) |
|
|
|
|
|
 |
|
 |
|
|
