advanced search user manual

	Toxin Name δ-ctenitoxin-Asp2e Source Species Ancylometes  sp. Toxin Group Ctenitoxin Description Based on the strong sequence homology (80% identity) to the insecticidal and vertebrate-active δ-ctenitoxin-Pn2a from the venom of the related ctenid spider Phoneutria nigriventer, this toxin is assumed to inhibit the inactivation of voltage-gated sodium channels. Discovered 2004 This toxin last updated on Aug 23, 2010 Taxonomy Current Taxonomy Kingdom Animalia Phylum Arthropoda Class Arachnida Order Araneae Infra-order Araneomorphae Family Ctenidae Genus Ancylometes Species sp. Biological Activity Neurotoxin Molecular Target ED50 IC50 Kd Pharmacophore Comment Sodium channel, voltage-gated (vertebrate) Based on sequence homologies to δ-ctenitoxin-Pn2a Accessions Source Accession ArachnoServer AS000016 NCBI_Taxon 280265 UniProt P84028 Literature References Original Deposition References Richardson M., Pimenta A.M.C., Bemquerer M.P., Santoro M.M., Figueiredo S.G., Cordeiro M.N. Submitted (JUN-2004) to UniProtKB. Protein ANC45C1 from venom of South American fishing spider (Ancylometes spp.) has sequence similarities to Na channel antagonists from venoms of Phoneutria spiders. Protein Information Disulfide Bonds Left Residue Right Residue Evidence 3 17 Predicted 10 23 Predicted 14 46 Predicted 16 31 Predicted 25 29 Predicted Sequences Peptide Sequences >as:δ-ctenitoxin-Asp2e|sp:P84028 Toxin from venom of the spider Ancylometes spec. with unknown molecular target ATCAGQDKPCKVNCDCCGERGECVCGGPCICRQGNVFIAWSKLMTCK Full BLAST BLAST mature toxin only Toxin Synonyms Synonym Type δ-ctenitoxin-Asp2e Recommended full name δ-CNTX-Asp2e Recommended abbreviation Neurotoxin ANC45C1 Synonym U2-ctenitoxin-Asp1a Synonym ANC45C1 Synonym (abbreviation) U2-CNTX-Asp1a Synonym (abbreviation)
©2010 Queensland Facility for Advanced Bioinformatics (Version 3.0) We greatly appreciate your feedback, comments or questions Internal: log in