 |
|
 |
| |
| Toxin Name |
ω-oxotoxin-Ol1a |
| Source Species |
Oxyopes lineatus (Lynx spider) |
| Toxin Group |
Oxotoxin |
| Description |
The primary structure of ω-oxotoxin-Ol1a is identical to that of ω-oxotoxin-Ot1a from the closely related spider Oxyopes takobius, although the latter is reported to have a non-amidated C-terminus.
ω-oxotoxin-Ol1a is insecticidal and was shown to be lethal at high dose to lepidopteran larvae, while being not toxic to mice at a dose of 31 pmol/g (=0.25 μg/g). The toxin is a weak blocker of vertebrate Cav1 and Cav2 voltage-gated calcium channels. |
| Discovered |
2006 |
|
|
| This toxin last updated on Aug 25, 2010 |
|
| Current Taxonomy |
Historic Taxonomy |
| Kingdom |
Animalia |
| Phylum |
Arthropoda |
| Class |
Arachnida |
| Order |
Araneae |
| Infra-order |
Araneomorphae |
| Family |
Oxyopidae |
| Genus |
Oxyopes |
| Species |
lineatus |
|
| "Oxyopes" "italicus" |
| "Oxyopes" "lineatus" |
| "Oxyopes" "lineatus gentilis" |
| "Oxyopes" "lineatus typicus" |
| "Sphasus" "gentilis" |
| "Sphasus" "italicus" |
| "Sphasus" "lineatus" |
|
|
| Molecular Target |
ED50 |
IC50 |
Kd |
Pharmacophore |
Comment |
| Calcium channel, voltage-gated (vertebrate): CaV1, non-specific |
|
|
|
|
|
| Calcium channel, voltage-gated (vertebrate): CaV2, non-specific |
|
|
|
|
|
| Taxon |
ED50 |
LD50 |
PD50 |
Qualitative Information |
| Spodoptera litura |
|
5000.0
pmol/g
|
|
|
|
| Original Deposition References |
Corzo G., Villegas E., Gomez-Lagunas F., Possani L.D., Belokoneva O.S., Nakajima T.
J. Biol. Chem. 277:23627-23637(2002).
Oxyopinins, large amphipathic peptides isolated from the venom of the wolf spider Oxyopes kitabensis with cytolytic properties and positive insecticidal cooperativity with spider neurotoxins.
|
| Other References |
Villegas E., Adachi-Akahane S., Bosmans F., Tytgat J., Nakajima T., Corzo G.
Toxicon 52:228-236(2008).
Biochemical characterization of cysteine-rich peptides from Oxyopes sp. venom that block calcium ion channels.
|
|
| Disulfide Bonds |
Posttranslational modifications |
| Left Residue |
Right Residue |
Evidence |
| 4 |
18 |
Predicted |
| 11 |
23 |
Predicted |
| 15 |
25 |
Predicted |
| 17 |
52 |
Predicted |
| 50 |
64 |
Predicted |
|
| Residue Number |
Type |
Symbol |
| 69 |
C-terminal amidation |
NH₂ |
|
|
| Peptide Sequences |
>as:ω-Oxotoxin-Ol1a|sp:P0C8M0 Insecticidal toxin (Oxytoxin-1) from the spider Oxyopes lineatus
DWECLPLHSSCDNDCVCCKNHHCHCPYSNVSKLEKWLPEWAKIPDALKRCSCQRNDKDGK
INTCDKYKN |
Full BLAST |
BLAST mature toxin only
|
|
| Synonym |
Type |
| ω-oxotoxin-Ol1a |
Recommended full name |
| ω-OXTX-Ol1a |
Recommended abbreviation |
| Oxytoxin-1 |
Synonym |
| OxyTx1 |
Synonym (abbreviation) |
|
|
|
|
|
 |
|
 |
|
|
