 |
|
 |
| |
| Toxin Name |
ω-oxotoxin-Ot1a |
| Source Species |
Oxyopes takobius |
| Toxin Group |
Oxotoxin |
| Description |
The primary structure of ω-oxotoxin-Ot1a is identical to that of ω-oxotoxin-Ol1a from the closely related spider Oxyopes lineatus, although the latter is reported to have an amidated C-terminus.
ω-oxotoxin-Ot1a is insecticidal and was shown to be lethal at high dose to lepidopteran larvae, while being not toxic to mice at a relatively low dose of 6.6 pmol/g (=0.05 μg/g). Based on its homology with ω-oxotoxin-Ol1a, this toxin is likely to be a weak blocker of vertebrate Cav1 and Cav2 voltage-gated calcium channels. |
| Discovered |
2002 |
|
|
| This toxin last updated on Sep 17, 2014 |
|
| Current Taxonomy |
Historic Taxonomy |
| Kingdom |
Animalia |
| Phylum |
Arthropoda |
| Class |
Arachnida |
| Order |
Araneae |
| Infra-order |
Araneomorphae |
| Family |
Oxyopidae |
| Genus |
Oxyopes |
| Species |
takobius |
|
|
|
| Molecular Target |
ED50 |
IC50 |
Kd |
Pharmacophore |
Comment |
| Calcium channel, voltage-gated (vertebrate): CaV1, non-specific |
|
|
|
|
|
| Calcium channel, voltage-gated (vertebrate): CaV2, non-specific |
|
|
|
|
|
| Taxon |
ED50 |
LD50 |
PD50 |
Qualitative Information |
| Spodoptera litura |
|
5100.0
pmol/g
|
|
Assays were performed using third instar larvae of mass 2-3 mg.
|
|
| Other References |
Corzo G., Villegas E., Gomez-Lagunas F., Possani L.D., Belokoneva O.S., Nakajima T
J. Biol. Chem. 277:23627-23637 (2002)
Oxyopinins, large amphipathic peptides isolated from the venom of the wolf spider Oxyopes kitabensis with cytolytic properties and positive insecticidal cooperativity with spider neurotoxins
|
Villegas E., Adachi-Akahane S., Bosmans F., Tytgat J., Nakajima T., Corzo G.T.
Toxicon 52:228-236 (2008)
Biochemical characterization of cysteine-rich peptides from Oxyopes sp. venom that block calcium ion channels
|
Sachkova M.Y., Slavokhotova A.A., Grishin E.V., Vassilevski A.A.
FEBS Lett. 588:740-5(2014).
Genes and evolution of two-domain toxins from lynx spider venom.
|
|
| Disulfide Bonds |
| Left Residue |
Right Residue |
Evidence |
| 4 |
18 |
Predicted |
| 11 |
23 |
Predicted |
| 15 |
25 |
Predicted |
| 17 |
52 |
Predicted |
| 50 |
64 |
Predicted |
|
|
| Peptide Sequences |
>as:ω-Oxotoxin-Ot1a_1|sp:P83288 Insecticidal toxin (Oxytoxin-1) from the spider Oxyopes takobius
DWECLPLHSSCDNDCVCCKNHHCHCPYSNVSKLEKWLPEWAKIPDALKRCSCQRNDKDGK
INTCDKYKN |
Full BLAST |
BLAST mature toxin only
|
>as:ω-Oxotoxin-Ot1a_2|sp:W0LP48 Insecticidal toxin (Oxytoxin-1) from the spider Oxyopes takobius
MKIVLVFVCTLYLAQATYLSEQDVNEVSEFLEALDQANEAASEMVEAAETEEARDWECLP
LHSSCDNDCVCCKNHHCHCPYSNVSKLEKWLPEWAKIPDALKRCSCQRNDKDGKINTCDK
YKN |
Full BLAST |
BLAST mature toxin only
|
|
| Synonym |
Type |
| ω-oxotoxin-Ot1a |
Recommended full name |
| ω-OXTX-Ot1a |
Recommended abbreviation |
| Oxytoxin-1 |
Synonym |
| OxyTx1 |
Synonym (abbreviation) |
| Tx-1 |
Synonym (abbreviation) |
|
|
|
|
|
 |
|
 |
|
|
