 |
|
 |
| |
| Toxin Name |
δ-ctenitoxin-Pr2d |
| Source Species |
Phoneutria reidyi (Brazilian Amazonian armed spider) |
| Toxin Group |
Ctenitoxin |
| Description |
Based on the strong sequence homology (89% identity) to the insecticidal and vertebrate-active δ-ctenitoxin-Pn2a from the related ctenid spider Phoneutria nigriventer, this toxin is assumed to inhibit the inactivation of voltage-gated sodium channels. |
| Discovered |
2004 |
|
Sex: Female, Prosoma length: 10mm
Photo courtesy of Bastian Rast
Use of photo governed by creative
commons noncommercial license
|
| This toxin last updated on Aug 23, 2010 |
|
| Current Taxonomy |
Historic Taxonomy |
| Kingdom |
Animalia |
| Phylum |
Arthropoda |
| Class |
Arachnida |
| Order |
Araneae |
| Infra-order |
Araneomorphae |
| Family |
Ctenidae |
| Genus |
Phoneutria |
| Species |
reidyi |
|
| "Ctenus" "andrewsi" |
| "Ctenus" "forcipatus" |
| "Ctenus" "reidyi" |
| "Phoneutria" "andrewsi" |
| "Phoneutria" "ochracea" |
| "Phoneutria" "reidyi" |
| "Phoneutria" "rufibarbis" |
|
|
| Molecular Target |
ED50 |
IC50 |
Kd |
Pharmacophore |
Comment |
| Sodium channel, voltage-gated (vertebrate) |
|
|
|
|
Based on sequence homologies to δ-ctenitoxin-Pn2a |
|
| Source |
Accession |
| ArachnoServer
|
AS000259 |
| NCBI_Taxon
|
272752
|
| UniProt
|
P83904
|
|
| Original Deposition References |
Richardson M., Pimenta A.M.C., Bemquerer M.P., Santoro M.M., Figueiredo S.G., Cordeiro M.N.
Submitted (APR-2004) to UniProtKB.
New neurotoxin PRTx32C1 from venom of Brazilian Amazonian armed spider Phoneutria reidyi.
|
| Other References |
Richardson M., Pimenta A.M., Bemquerer M.P., Santoro M.M., Beirao P.S., Lima M.E., Figueiredo S.G., Bloch C. Jr., Vasconcelos E.A., Campos F.A., Gomes P.C., Cordeiro M.N.
Comp Biochem Physiol C Toxicol Pharmacol. 142(3-4):173-87 (2006)
Comparison of the partial proteomes of the venoms of Brazilian spiders of the genus Phoneutria.
|
|
| Disulfide Bonds |
| Left Residue |
Right Residue |
Evidence |
| 3 |
17 |
Predicted |
| 10 |
23 |
Predicted |
| 14 |
46 |
Predicted |
| 16 |
31 |
Predicted |
| 25 |
29 |
Predicted |
|
|
| Peptide Sequences |
>as:δ-ctenitoxin-Pr2d|sp:P83904 Toxin from venom of the spider Phoneutria reidyi that is assumed to inhibit the inactivation of voltage-gated sodium channels
GTCAGQDKPCKETCDCCGERGQCVCEGPCICRQGYFWIAAYKLGNCK |
Full BLAST |
BLAST mature toxin only
|
|
| Synonym |
Type |
| δ-ctenitoxin-Pr2d |
Recommended full name |
| δ-CNTX-Pr2d |
Recommended abbreviation |
| Neurotoxin PRTx32C1 |
Synonym |
| U5-ctenitoxin-Pr1a |
Synonym |
| PRTx32C1 |
Synonym (abbreviation) |
| U5-CNTX-Pr1a |
Synonym (abbreviation) |
|
|
|
|
|
 |
|
 |
|
|
