 |
|
 |
| |
| Toxin Name |
CRISP-1-Phoneutria keyserlingi |
| Source Species |
Phoneutria keyserlingi (Brazilian wandering spider) |
| Toxin Group |
Ctenitoxin |
| Description |
Partial sequence of a venom allergen, similar to that found in hymenopterans. Belongs to the CAP protein family that includes CRISP proteins, antigen 5, and pathogenesis-related (PR-1) proteins. Has been convergently recruited into the venom of a variety of animals, including cepahalopods, cone snails, scorpions, reptiles and ticks, as well as the saliva of hematophagous insects. CAP domain proteins are the dominant allergy-inducing toxins in hymenopteran venoms. Its function in spider venoms remains to be determined. A similar protein has been found in the venom of Lycosa singoriensis. |
| Discovered |
2008 |
|
Sex: female, Prosoma length: 8mm
Photo courtesy of Bastian Rast
Use of photo governed by creative
commons noncommercial license
|
| This toxin last updated on Oct 29, 2014 |
|
| Current Taxonomy |
Historic Taxonomy |
| Kingdom |
Animalia |
| Phylum |
Arthropoda |
| Class |
Arachnida |
| Order |
Araneae |
| Infra-order |
Araneomorphae |
| Family |
Ctenidae |
| Genus |
Phoneutria |
| Species |
keyserlingi |
|
| "Phoneutria" "keyserlingi" |
| "Ctenus" "keyserlingii" |
|
|
| Molecular Target |
ED50 |
IC50 |
Kd |
Pharmacophore |
Comment |
| Molecular target unknown |
|
|
|
|
|
|
| Original Deposition References |
Richardson M., Souza I.A., Rezende F.F., Borges M.H., Sousa A., Cordeiro M.N.
Submitted (MAY-2008) to UniProtKB.
Allergenic protein in venom of spider Phoneutria keyserlingi.
|
| Other References |
Fry B.G., Roelants K., Champagne D.E., Scheib H., Tyndall J.D., King G.F., Nevalainen T.J., Norman J.A., Lewis R.J., Norton R.S., Renjifo C., de la Vega R.C.
Annu Rev Genomics Hum Genet 10:483-511 (2009).
The toxicogenomic multiverse: convergent recruitment of proteins into animal venoms.
|
|
| Peptide Sequences |
>as:CRISP-1-Phoneutria keyserlingi|sp:P85860 CRISP-1-Phoneutria keyserlingi (Allergen (antigen 5)) from the venom of the spider Phoneutria keyserlingi
GLCPDKYKRYSLQHSFCLPTCVSCAFYSKDVRYWLKNYILYQHNNLRNVVASGRSYGVDH
VPRICLTVVTRIGCGYLFRKYTNVICNYGPRGNVEGEEIYKGGDICSACPANTCCGDGCK
YHGLCKFGEPNLPEIFYCGFNGESDCR |
Full BLAST
|
|
| Synonym |
Type |
| Venom allergen |
Recommended full name |
| CRISP-1-Phoneutria keyserlingi |
Recommended full name |
| Antigen 5 |
Synonym |
|
|
|
|
|
 |
|
 |
|
|
