 |
|
 |
| |
| Toxin Name |
U2-ctenitoxin-Cs1a |
| Source Species |
Cupiennius salei (Wandering spider) |
| Toxin Group |
Ctenitoxin |
| Description |
This toxin alone has very weak insecticidal activity, with an unknown molecular target. However, it acts as as a "neurotoxic enhancer", synergistically enhancing the neurotoxic action of ω-CNTX-Cs1a (CSTX-1), the major neurotoxic component of Cupiennius salei venom. The toxin has a very unusual structure; it is composed of two peptide chains (chain A = residues 1-34 and chain B = residues 35-63), with two interchain and two intrachain disulfide bridges. |
| Discovered |
2004 |
|
Sex: female
Photo courtesy of Bastian Rast
Use of photo governed by creative
commons noncommercial license
|
| This toxin last updated on Jul 27, 2010 |
|
| Current Taxonomy |
Historic Taxonomy |
| Kingdom |
Animalia |
| Phylum |
Arthropoda |
| Class |
Arachnida |
| Order |
Araneae |
| Infra-order |
Araneomorphae |
| Family |
Ctenidae |
| Genus |
Cupiennius |
| Species |
salei |
|
| Ancylometes ahrensi |
| Ctenus mordicus |
| Ctenus oculatus |
| Ctenus salei |
| Cupiennius ahrensi |
| Cupiennius salei |
| Cupiennius sallei |
| Phoneutria oculifera |
|
|
| Taxon |
ED50 |
LD50 |
PD50 |
Qualitative Information |
| Drosophila melanogaster |
|
16300.0
pmol/g
|
|
LD50 calculated based on literature value of 16.3 nmol/g
|
|
| Original Deposition References |
Wullschleger B., Kuhn-Nentwig L., Tromp J., Kaempfer U., Schaller J., Schuerch S., Nentwig W.
Proc. Natl. Acad. Sci. U.S.A. 101:11251-11256(2004).
CSTX-13, a highly synergistically acting two-chain neurotoxic enhancer in the venom of the spider Cupiennius salei (Ctenidae).
|
| Other References |
Kuhn-Nentwig L., Schaller J., Nentwig W.
Toxicon 43:543-53 (2004)
Biochemistry, toxicology and ecology of the venom of the spider Cupiennius salei (Ctenidae).
|
Wullschleger B., Nentwig W., Kuhn-Nentwig L.
J. Exp. Biol. 208:2115-2121(2005).
Spider venom: enhancement of venom efficacy mediated by different synergistic strategies in Cupiennius salei.
|
|
| Disulfide Bonds |
Posttranslational modifications |
| Left Residue |
Right Residue |
Evidence |
| 3 |
18 |
Experimentally determined |
| 10 |
27 |
Experimentally determined |
| 17 |
42 |
Experimentally determined |
| 29 |
40 |
Experimentally determined |
|
| Residue Number |
Type |
Symbol |
| 63 |
C-terminal amidation |
NH₂ |
|
|
| Peptide Sequences |
>as:U2-ctenitoxin-Cs1a|sp:P83919 Toxin from venom of the spider Cupiennius salei with unknown molecular target
SDCTLRNHDCTDDRHSCCRSKMFKDVCTCFYPSQAKKELCTCQQPKHLKYIEKGLQKAKD
YAT |
Full BLAST |
BLAST mature toxin only
|
|
| Synonym |
Type |
| U2-ctenitoxin-Cs1a |
Recommended full name |
| U2-CNTX-Cs1a |
Recommended abbreviation |
| CSTX-13 |
Synonym |
|
|
|
|
|
 |
|
 |
|
|
