 |
|
 |
| |
| Toxin Name |
μ-theraphotoxin-Hhn2j |
| Source Species |
Haplopelma hainanum (Chinese Black Earth Tiger tarantula) |
| Toxin Group |
Theraphotoxin |
| Description |
Based on the homology to μ-theraphotoxin-Hhn2a from the same species, this toxin is presumed to inhibit neuronal voltage-gated sodium (Nav) channels. |
| Discovered |
2010 |
|
|
| This toxin last updated on Aug 26, 2014 |
|
| Current Taxonomy |
Historic Taxonomy |
| Kingdom |
Animalia |
| Phylum |
Arthropoda |
| Class |
Arachnida |
| Order |
Araneae |
| Infra-order |
Mygalomorphae |
| Family |
Theraphosidae |
| Genus |
Haplopelma |
| Species |
hainanum |
|
| "Ornithoctonus" "hainana" |
| "Haplopelma" "hainanum" |
| "Selenocosmia" "hainana" |
|
|
| Molecular Target |
ED50 |
IC50 |
Kd |
Pharmacophore |
Comment |
| Sodium channel, voltage-gated (vertebrate): Vertebrate NaV channel, non-selective |
|
|
|
|
Based on homology to μ-theraphotoxin-Hhn2a |
|
| Original Deposition References |
Tang X., Zhang Y., Hu W., Xu D., Tao H., Yang X., Li Y., Jiang L., Liang S.
J. Proteome Res. 9:2550-2564(2010).
Molecular diversification of peptide toxins from the tarantula Haplopelma hainanum (Ornithoctonus hainana) venom based on transcriptomic, peptidomic, and genomic analyses.
|
|
| Disulfide Bonds |
Posttranslational modifications |
| Left Residue |
Right Residue |
Evidence |
| 2 |
17 |
By homology |
| 9 |
22 |
By homology |
| 16 |
29 |
By homology |
|
| Residue Number |
Type |
Symbol |
| 33 |
C-terminal amidation |
NH₂ |
|
|
| Peptide Sequences |
>as:μ-theraphotoxin-Hhn2j_1|sp:D2Y1Y5 Toxin from venom of the spider Haplopelma hainanum that inhibits voltage-gated sodium channels
MKASMFLALAGLVLLFVVGYASESEEKEFPIELLSKIFAVDVFKGEDRGCKGFGDSCTPG
KNECCPNHACSNKHKWCKVYLGK |
Full BLAST |
BLAST mature toxin only
|
>as:μ-theraphotoxin-Hhn2j_2|sp:D2Y1Z3 Toxin from venom of the spider Haplopelma hainanum that inhibits voltage-gated sodium channels
MKALMFLALAGLVLLFVVGYASESEEKEFPIELLSKIFAVDVFKGEERGCKGFGDSCTPG
KNECCPNHACSNKHKWCKVYLGK |
Full BLAST |
BLAST mature toxin only
|
>as:μ-theraphotoxin-Hhn2j_3|sp:D2Y1Z5 Toxin from venom of the spider Haplopelma hainanum that inhibits voltage-gated sodium channels
MKASMFLALAGSVLLFVVGYASESEEKEFPIELLSKIFAVDVFKGEERGCKGFGDSCTPG
KNECCPNHACSNKHKWCKVYLGK |
Full BLAST |
BLAST mature toxin only
|
>as:μ-theraphotoxin-Hhn2j_4|sp:D2Y1Z6 Toxin from venom of the spider Haplopelma hainanum that inhibits voltage-gated sodium channels
MKASMFLALAGLVLLFVVGYASESEEKEFPIELLSKIFAVDVFKGEGRGCKGFGDSCTPG
KNECCPNHACSNKHKWCKVYLGK |
Full BLAST |
BLAST mature toxin only
|
>as:μ-theraphotoxin-Hhn2j_5|sp:D2Y1Y4 Toxin from venom of the spider Haplopelma hainanum that inhibits voltage-gated sodium channels
MKASMFLALAGLVLLFVVGYASESEEKEFPIELLSKIFAVDVFKGEERGCKGFGDSCTPG
KNECCPNHACSNKHKWCKVYLGK |
Full BLAST |
BLAST mature toxin only
|
|
| Synonym |
Type |
| μ-theraphotoxin-Hhn2j |
Recommended full name |
| μ-TRTX-Hhn2j |
Recommended abbreviation |
| Hainantoxin-III-2 |
Synonym |
| Hainantoxin-III-2.4 |
Synonym |
| Hainantoxin-III-2.2 |
Synonym |
| Hainantoxin-III-2.5 |
Synonym |
| Hainantoxin-III-2.3 |
Synonym |
| HNTX-III-2 |
Synonym (abbreviation) |
| HNTX-III-2.5 |
Synonym (abbreviation) |
| HNTX-III-2.2 |
Synonym (abbreviation) |
| HNTX-III-2.3 |
Synonym (abbreviation) |
| HNTX-III-2.4 |
Synonym (abbreviation) |
|
|
|
|
|
 |
|
 |
|
|
